Basic Information | |
---|---|
Taxon OID | 3300010356 Open in IMG/M |
Scaffold ID | Ga0116237_10324760 Open in IMG/M |
Source Dataset Name | AD_USDEca |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1390 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 39.84 | Long. (o) | -89.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059098 | Metagenome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116237_103247601 | F059098 | N/A | MSNVLVNFRLNPDRPVRVKWLATDGVPGDGYKAQITAVKVQKKTIEMDSSAILEQSAADPTGGVGAYMVTFNGMVGFGDDHPHRKLV |
⦗Top⦘ |