Scaffold Ga0116236_10674990

Overview

Basic Information

• Taxon OID: 3300010353
• Scaffold ID: Ga0116236_10674990
• Source Dataset Name: AD_USCAca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 842
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 33.8
  • Long. (^o): -118.28

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043390	Metagenome / Metatranscriptome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116236_106749902	F043390	AGG	MNLGYCTFFSGGDKKMGYMVKNEDSQKVITLTLTAEQLEVIDGALEMYCMGLAEHNDPYLPKANDAHEAIYNVLESNFGAEV*