NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116236_10595361

Scaffold Ga0116236_10595361


Overview

Basic Information
Taxon OID3300010353 Open in IMG/M
Scaffold IDGa0116236_10595361 Open in IMG/M
Source Dataset NameAD_USCAca
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)911
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)33.8Long. (o)-118.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046176Metagenome151N

Sequences

Protein IDFamilyRBSSequence
Ga0116236_105953613F046176N/ADVLQLPAKPEPKPAPATPARPVEWVPQFHMTTSDQEKDPYALLLDLPGPNVKMTPDNMRELARYLVDAAEICEKRQYRGLKNFSLFRENERFRSSVVLVPFNQMRDLQTLALAALRSGDVLAETKEKYVVQFIREGLQHQLPLINMQLKKQGMRSISFKSLK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.