Basic Information | |
---|---|
Taxon OID | 3300010352 Open in IMG/M |
Scaffold ID | Ga0116247_10013850 Open in IMG/M |
Source Dataset Name | AD_JPHWca |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9382 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium ADurb.Bin341 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan | |||||||
Coordinates | Lat. (o) | 35.92 | Long. (o) | 139.63 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F063339 | Metagenome | 129 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116247_1001385010 | F063339 | N/A | HRARPWASYAGRKATMNTMLTTLGTQAEFHQTWQALMQQLEILLSIAHRRSPNRTETLEAVSIAKYLLGKVGDQLDKAVQE* |
⦗Top⦘ |