| Basic Information | |
|---|---|
| Taxon OID | 3300010348 Open in IMG/M |
| Scaffold ID | Ga0116255_10101146 Open in IMG/M |
| Source Dataset Name | AD_HKYLca |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2262 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hong Kong | |||||||
| Coordinates | Lat. (o) | 22.28 | Long. (o) | 114.17 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025288 | Metagenome / Metatranscriptome | 202 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116255_101011461 | F025288 | N/A | APMKNKWIWITLSVILVLGLIAGAGALGYQMGLRNANAIASQADGDKTLPRTLMPGMRNTLNGLIIRRPAGFIGYLFLLPLRVLFGLAVLLLVVWLVVKVAKAAWDGGNHKPKPADATVSSAPTETLITEVPASPSEPTSTPENDQK* |
| ⦗Top⦘ |