Basic Information | |
---|---|
Taxon OID | 3300010347 Open in IMG/M |
Scaffold ID | Ga0116238_10623210 Open in IMG/M |
Source Dataset Name | AD_JPHGca |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 672 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan | |||||||
Coordinates | Lat. (o) | 34.72 | Long. (o) | 135.27 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F089690 | Metagenome / Metatranscriptome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116238_106232101 | F089690 | N/A | LRVWNDAPTGTPAETYKVDKFKGAQLTKLSFSGASGDMVKYEATFNITTFEREISQKITGTKPAFSAIADGLFNFGDMEFDLAYGENNDAKSFSFNIGYEFPDDNTQYMNSLTRLPAIPLRVAGEFSYVNNYHKNGNEKILETLLYNNNQVEEQAFNLKSGSNSWYFDFFCQPINYSLADPDKALFENNITERLVLSSNDLGVNNLLLIIIT* |
⦗Top⦘ |