Scaffold Ga0116238_10009317

Overview

Basic Information

• Taxon OID: 3300010347
• Scaffold ID: Ga0116238_10009317
• Source Dataset Name: AD_JPHGca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12224
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 34.72
  • Long. (^o): 135.27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016758	Metagenome / Metatranscriptome	245	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116238_100093178	F016758	AGGAG	MNVKGIIYMTGKNAIVEVFGLEPWNSFMAKLAAKDKFFSNPIMSITPVPLDKFILFLDELVKEFFNNDMMQYVTFGKVAAQFVLSDEGMYKAYRLTKDKKTIVEMIVPKLWATYFDEGMVTAKLENNVAYFKVTGLKFKHRYFEYLVMGFLQKALKIYGMKNVPKLLRSMVAGDEDVCYQFELKDA*