Scaffold Ga0116239_10633491

Overview

Basic Information

• Taxon OID: 3300010346
• Scaffold ID: Ga0116239_10633491
• Source Dataset Name: AD_USMOca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 690
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA
• Coordinates
  • Lat. (^o): 41.53
  • Long. (^o): -90.43

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070274	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116239_106334912	F070274	N/A	ILFNFVVRLDPSSCCPGKKAGAEAKKGREMPFRLPPVCFRKRKRKQRGPQAETAEARYGKRETTAFFSEANVFLPGHGTLWQ*