Scaffold Ga0116253_10063337

Overview

Basic Information

• Taxon OID: 3300010345
• Scaffold ID: Ga0116253_10063337
• Source Dataset Name: AD_JPNAca2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2809
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 37.43
  • Long. (^o): 138.83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104720	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116253_100633373	F104720	GGA	MTVALIILAIVFAVIAHALGCISGYAKMICDLSEEEKLNFLPKEYWHKRISSVNKHQYTGKIKAWLMKNLLVMFTDGWHKYQFILTICLLVSGFFVGFISGKITPYYSFMLLSVYFVRTTTFHLLYNSKKYRK*