Scaffold Ga0074045_10088939

Overview

Basic Information

• Taxon OID: 3300010341
• Scaffold ID: Ga0074045_10088939
• Source Dataset Name: Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2151
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location

• Location Name: Calvert Island, British Columbia, Canada
• Coordinates
  • Lat. (^o): 51.62
  • Long. (^o): -128.09

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038174	Metagenome / Metatranscriptome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074045_100889392	F038174	GGA	MTERLSKSLRDNKISNVTMDSSTTTDYKLHLTVENGDEAKSKECDYILLTQIVDPKAHPEDPHPPPISIGGKVPSIDASDPLGGSSGPVYRDNLQISVALFRVGRFEAVLDTVILAQPTGNASDNLLSAMDKESNRVGHELKKR*