| Basic Information | |
|---|---|
| Taxon OID | 3300010341 Open in IMG/M |
| Scaffold ID | Ga0074045_10081779 Open in IMG/M |
| Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2260 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Calvert Island, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004702 | Metagenome / Metatranscriptome | 427 | Y |
| F019512 | Metagenome / Metatranscriptome | 229 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074045_100817791 | F019512 | N/A | LALAIVLGPIGCGHSSSDSSADEGIPGLTSADREAQSAAMAELQRHWRKGSEGWTTAIVSGSPYAPDHFLRQCRALTIKAMVPQDLSESDKLNGFEWIGRAEFQPTSCREGGGQPGMVLDGMSNVVVSKHSGQWSQWVDFTPGPLRFAREKGRWQFNWDATYLRGTLPGPQDFAIA |
| Ga0074045_100817792 | F004702 | AGGAG | MNGSAIRNALLVMVLASSALVVGCGGGAEGKYRDPSGTINAEFKDGKAYVALGAYAVDGTYKIDGNKIVARGDFGPMLPSPLIFTVNKDGTIDGPRDTMIPRLEKVK* |
| ⦗Top⦘ |