Scaffold Ga0123336_10081974

Overview

Basic Information

• Taxon OID: 3300010331
• Scaffold ID: Ga0123336_10081974
• Source Dataset Name: Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1960
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Borup Fiord, Nunavut, Canada
• Coordinates
  • Lat. (^o): 81.017
  • Long. (^o): -81.583
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067349	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123336_100819744	F067349	GGCGG	MVAPNRPSILISAALAVATPLLGGAMAWRLLDDAGRSGLVYVLVYWPSILIDALPTVAADAFTESALPTVLLYFGGYLLVCQAVRSLWRRVR*