Basic Information | |
---|---|
Taxon OID | 3300010328 Open in IMG/M |
Scaffold ID | Ga0129298_10295744 Open in IMG/M |
Source Dataset Name | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 748 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indonesia: Gulf of Boni | |||||||
Coordinates | Lat. (o) | -2.75 | Long. (o) | 121.05 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084958 | Metagenome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129298_102957441 | F084958 | N/A | LFFRSYTTDPMSENHRLKHLRNEQIVVTSVDLAKKALDFMNHVRKRQAEDRPYHVKEWRDYISKDGLTVSTYETTKSRLLASGLLRQESRILTISSPTEFESTLSKMLNAVQVWREYGR* |
⦗Top⦘ |