Scaffold Ga0129298_10030939

Overview

Basic Information

• Taxon OID: 3300010328
• Scaffold ID: Ga0129298_10030939
• Source Dataset Name: Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2551
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_53_10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Indonesia: Gulf of Boni
• Coordinates
  • Lat. (^o): -2.75
  • Long. (^o): 121.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046459	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129298_100309394	F046459	AGGAG	MRKMIIWVVAGLAILNGCASYLSYDRYSTSDIPFHKRKPPSLDKAIIISTNGPQLELKYYEIMGNVISQISNITIFQNHCKDAIEMLRYEAENVGADALINVSCSSGKYNADASGTAIAFKNREQALRVLKEIKAILE*