| Basic Information | |
|---|---|
| Taxon OID | 3300010318 Open in IMG/M |
| Scaffold ID | Ga0136656_1043385 Open in IMG/M |
| Source Dataset Name | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1625 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Chesapeake Bay | |||||||
| Coordinates | Lat. (o) | 37.5161 | Long. (o) | -76.1223 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002564 | Metagenome / Metatranscriptome | 547 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136656_10433854 | F002564 | GAGG | MALTISRGTNLVEHHQTTPLTLVNDSLEVHVDTSEFTFAAIVTGGANFTLAFEANYNGGGTWFELDTSKTINSNGQYAYFYSGKPANKVRMRISAISSGTPSVVPIIAAAYHG* |
| ⦗Top⦘ |