| Basic Information | |
|---|---|
| Taxon OID | 3300010315 Open in IMG/M |
| Scaffold ID | Ga0136654_1151983 Open in IMG/M |
| Source Dataset Name | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1163 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hawaii, USA | |||||||
| Coordinates | Lat. (o) | 21.2833 | Long. (o) | -157.8469 | Alt. (m) | Depth (m) | 3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002469 | Metagenome | 556 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136654_11519832 | F002469 | N/A | MAMVDVDGSRQFSADSRPKSTGLV*GLAATRRSVYIHQMNRVNSRNDFGHDDSTINI |
| ⦗Top⦘ |