NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116254_1055417

Scaffold Ga0116254_1055417


Overview

Basic Information
Taxon OID3300010311 Open in IMG/M
Scaffold IDGa0116254_1055417 Open in IMG/M
Source Dataset NameAD_JPTRca
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1275
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan
CoordinatesLat. (o)34.65Long. (o)135.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021262Metagenome / Metatranscriptome219N
F024321Metagenome / Metatranscriptome206N
F049316Metagenome / Metatranscriptome147N

Sequences

Protein IDFamilyRBSSequence
Ga0116254_10554171F049316AGGAGGMNKDKRITTIVLDKEADRKSKIIAEFTGKTLSAIYREALDMYFSHFVNNDLLSEVNEFLDKLYWQYKIDNPHIFTAIQFGNLADAAVMIAEAVKQLPQEPE
Ga0116254_10554172F021262AGGAGMSKKYYVKLTTGREFTGTAKEIVTQLRNESRLLAITPRKYAKLVAKSYEMSTGLKLHTWTYNSFVKSLGKSLMVMEFKEVK*
Ga0116254_10554173F024321GGAGGMLEEILKLIAGMAGLGAFTSMLINLLKAVGLVKDGQADKAFKIADLIVFVIITVIYLTKTPVDWAQVDEWLVLLTALLGYVVSVFSGEFTHDTIKGTPLIGYSYSEKKLKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.