| Basic Information | |
|---|---|
| Taxon OID | 3300010303 Open in IMG/M |
| Scaffold ID | Ga0134082_10086624 Open in IMG/M |
| Source Dataset Name | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1230 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Angelo Coastal Reserve, California | |||||||
| Coordinates | Lat. (o) | 39.7181 | Long. (o) | -123.6527 | Alt. (m) | Depth (m) | .4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000628 | Metagenome / Metatranscriptome | 973 | Y |
| F023159 | Metagenome / Metatranscriptome | 211 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134082_100866241 | F023159 | N/A | MGAGKTTFYEAHLKGAFPTLIPPISHQRETALREQRSFAVEDLVVDTDLVESARDAGYATKIVFISR |
| Ga0134082_100866242 | F000628 | AGGAGG | VAIRRNVGFDVFNVRLLVGLDKLLRAKRRYQGYLSASINDALLAVNLDTVKLVTLQGKKKQTARETQVVLLRRLIRKLHKVAETRRCSINQLVNSGLAAYYSKQRLTKPRLPSRPTQKSASYDQMSTAERQRLVEALGNLAGRQEGPRSTFPDGSRYEYDPKLKRTVEVASSGKRYPVALVAGRFQRGAAHATARKAAR* |
| ⦗Top⦘ |