Basic Information | |
---|---|
Taxon OID | 3300010300 Open in IMG/M |
Scaffold ID | Ga0129351_1117460 Open in IMG/M |
Source Dataset Name | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1062 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Chesapeake Bay | |||||||
Coordinates | Lat. (o) | 37.0306 | Long. (o) | -76.0464 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F070203 | Metagenome | 123 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129351_11174601 | F070203 | N/A | AEYPSLQEFAEAYCEKEIGGSSTKWDAYKTAYNKVRTDNPKE* |
⦗Top⦘ |