Scaffold Ga0116204_1285308

Overview

Basic Information

• Taxon OID: 3300010293
• Scaffold ID: Ga0116204_1285308
• Source Dataset Name: Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Rwanda: Lake Kivu
• Coordinates
  • Lat. (^o): -1.78
  • Long. (^o): 29.2
  • Depth (m): 52

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015864	Metagenome / Metatranscriptome	251	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116204_12853081	F015864	N/A	MTDLRYSTGEELFEFLYAKCREDHDLLAMIVDEYIVSLSDNKLIELEDFLTNN