Scaffold Ga0134101_1084671

Overview

Basic Information

• Taxon OID: 3300010267
• Scaffold ID: Ga0134101_1084671
• Source Dataset Name: Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 12_48_3.3_201_A2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 527
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location

• Location Name: USA: Dartmouth College, New Hampshire
• Coordinates
  • Lat. (^o): 43.726
  • Long. (^o): -72.1429

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002059	Metagenome / Metatranscriptome	597	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134101_10846711	F002059	N/A	KFVPRSRVGIFHNKGTRSSPLHSKMMFWCISYYLGAFGTVWLHYENRSKKGRISAKVRATKSRRNFSQRTYRVHPIRPQTDVLVCFILFWCIWDRLVPLRNSVQNGPNKCKSSCHEVVSEFFATNAPGPPHWTLN*