| Basic Information | |
|---|---|
| Taxon OID | 3300010241 Open in IMG/M |
| Scaffold ID | Ga0136483_101237 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from clay sediment within the South China Sea |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 679 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanophagales → unclassified Methanophagales → Methanophagales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South China Sea | |||||||
| Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016493 | Metagenome / Metatranscriptome | 246 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136483_1012372 | F016493 | N/A | FGDKIGKFRQVSDPYFSMHITGKFLFGMGLGLLLAIWLPIWIGWVFIVASLLIAIPSARIILGK* |
| ⦗Top⦘ |