Scaffold Ga0136450_100000590

Overview

Basic Information

• Taxon OID: 3300010240
• Scaffold ID: Ga0136450_100000590
• Source Dataset Name: Terrestrial oil reservoir microbial community from Kuparuk Formation, Alaska - K2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Yale Center for Genome Analysis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10332
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 20 (86.96%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska

Source Dataset Sampling Location

• Location Name: Alaska, USA
• Coordinates
  • Lat. (^o): 70.4
  • Long. (^o): -148.7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079441	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136450_10000059021	F079441	GGA	MRLESYELVEQLKTLNENIRTLNSILKDWANITNRLDEQIRLLETQRYSSKYWQFEPIEHYDLETLQPGEVTNLLSTTESGAFVLFSSFTTSDKVYWEVRVDDLVIKGTIEDLYNYGLIGYNPRTLWISAGNGGYAVWATPNPYIEYRNKIQVYGKNVGDTEIQYNYIIFRYKYIGGD*