| Basic Information | |
|---|---|
| Taxon OID | 3300010234 Open in IMG/M |
| Scaffold ID | Ga0136261_1086333 Open in IMG/M |
| Source Dataset Name | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Fidelity Systems Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 675 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangor, North Wales, UK | |||||||
| Coordinates | Lat. (o) | 53.23 | Long. (o) | -4.13 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068865 | Metagenome / Metatranscriptome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136261_10863331 | F068865 | N/A | MLLGVLIWLQAQFAGAHSTITLERHTEVVDKIEGQLADAMTEKDRIHLQGPSDLVSEVLARTNAIALAGCAVSVLGLLLLIAEVTRKKGSKTLE |
| ⦗Top⦘ |