NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136261_1060327

Scaffold Ga0136261_1060327


Overview

Basic Information
Taxon OID3300010234 Open in IMG/M
Scaffold IDGa0136261_1060327 Open in IMG/M
Source Dataset NameFreshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFidelity Systems Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)814
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Source Dataset Sampling Location
Location NameBangor, North Wales, UK
CoordinatesLat. (o)53.23Long. (o)-4.13Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023060Metagenome / Metatranscriptome211N

Sequences

Protein IDFamilyRBSSequence
Ga0136261_10603271F023060N/AEAKPYTGKAFSAIALSKIPYENLYYRNGTKFIEITWRNGRRSFPYPLSKAKALELFIEHDDPEQPYLLVGKASLVPNTQKMLYFVGLNGSKQEGQLPLKLYGIDDSETIFPDSSYRFINFVKVPLVVDFDKKKRFLIKPGKPIVHKLNLSKGGEFTPFVLRDTKGKVLGGTRLFSHANNREMVLIFPPKKGSKRMDIRFFSD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.