Scaffold Ga0136261_1026655

Overview

Basic Information

• Taxon OID: 3300010234
• Scaffold ID: Ga0136261_1026655
• Source Dataset Name: Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1417
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Source Dataset Sampling Location

• Location Name: Bangor, North Wales, UK
• Coordinates
  • Lat. (^o): 53.23
  • Long. (^o): -4.13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009761	Metagenome / Metatranscriptome	313	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136261_10266551	F009761	N/A	NILKDPASIGGRDVFKASLFTGYELPKINIMNKTKR*