Scaffold Ga0136261_1018535

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136261_1018535

Scaffold Ga0136261_1018535

Overview

Basic Information
Taxon OID	3300010234 Open in IMG/M
Scaffold ID	Ga0136261_1018535 Open in IMG/M
Source Dataset Name	Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1810
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Source Dataset Sampling Location
Location Name	Bangor, North Wales, UK
Coordinates	Lat. (^o)	53.23	Long. (^o)	-4.13	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082775	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136261_10185351	F082775	AGGAGG	MNEPDILYPAIFVFSMLLIGLVLTIWEFSRLQKRKQQMQEKGGHVANREFH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.