Scaffold Ga0136261_1005307

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136261_1005307

Scaffold Ga0136261_1005307

Overview

Basic Information
Taxon OID	3300010234 Open in IMG/M
Scaffold ID	Ga0136261_1005307 Open in IMG/M
Source Dataset Name	Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4331
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	16 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Source Dataset Sampling Location
Location Name	Bangor, North Wales, UK
Coordinates	Lat. (^o)	53.23	Long. (^o)	-4.13	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060822	Metagenome / Metatranscriptome	132	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136261_10053071	F060822	AGGAG	MKTKKEKDKTDIECEHIDTDNNNSVYMFHNIKNNIHLFINASNLEDAMVQFDLCNFSFRYEWKIFLETGQQPT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.