NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136235_1045345

Scaffold Ga0136235_1045345


Overview

Basic Information
Taxon OID3300010233 Open in IMG/M
Scaffold IDGa0136235_1045345 Open in IMG/M
Source Dataset NameFilterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFidelity Systems Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)880
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk

Source Dataset Sampling Location
Location NameConwy River, Conwy, North Wales, UK
CoordinatesLat. (o)53.2Long. (o)-3.82Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009203Metagenome / Metatranscriptome321Y

Sequences

Protein IDFamilyRBSSequence
Ga0136235_10453452F009203GGAMTEQTDNIKNVLDFVAIFSTFGAFLEMFNPLFALIGAVVGVMRIYEMATGKEFYTLFRRKKNGDAEHE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.