Scaffold Ga0136235_1014175

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136235_1014175

Scaffold Ga0136235_1014175

Overview

Basic Information
Taxon OID	3300010233 Open in IMG/M
Scaffold ID	Ga0136235_1014175 Open in IMG/M
Source Dataset Name	Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1949
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk

Source Dataset Sampling Location
Location Name	Conwy River, Conwy, North Wales, UK
Coordinates	Lat. (^o)	53.2	Long. (^o)	-3.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094794	Metagenome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136235_10141752	F094794	GGAG	MTKTNTLQTKEKLHFEDIIQNGENSLGFTAQTANGTAHWEGTGWNKTLFNDYDMPQLQPDATRPSGRSNRTGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.