| Basic Information | |
|---|---|
| Taxon OID | 3300010233 Open in IMG/M |
| Scaffold ID | Ga0136235_1005204 Open in IMG/M |
| Source Dataset Name | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Fidelity Systems Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4108 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Conwy River, Conwy, North Wales, UK | |||||||
| Coordinates | Lat. (o) | 53.2 | Long. (o) | -3.82 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016965 | Metagenome / Metatranscriptome | 243 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136235_10052046 | F016965 | N/A | MIFNYNGIEYTITGPIEVISDTQIHVPTDKGIILVDDTMDIFKELVSQ* |
| ⦗Top⦘ |