Scaffold Ga0136235_1001502

Overview

Basic Information

• Taxon OID: 3300010233
• Scaffold ID: Ga0136235_1001502
• Source Dataset Name: Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10464
• Total Scaffold Genes: 23
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (82.61%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk

Source Dataset Sampling Location

• Location Name: Conwy River, Conwy, North Wales, UK
• Coordinates
  • Lat. (^o): 53.2
  • Long. (^o): -3.82

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093759	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136235_100150220	F093759	GGAG	MLKVTFYVFSKILNKEFRNVEMHKSMDDAKLRACALNWQIESVEAA*