| Basic Information | |
|---|---|
| Taxon OID | 3300010230 Open in IMG/M |
| Scaffold ID | Ga0136236_1009111 Open in IMG/M |
| Source Dataset Name | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Fidelity Systems Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1118 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Conwy River, Conwy, North Wales, UK | |||||||
| Coordinates | Lat. (o) | 53.2 | Long. (o) | -3.82 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005200 | Metagenome | 408 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136236_10091111 | F005200 | GAGG | VDPITIFAACKAAHAGIRECIDLYQDFKKDGKDVGDIVGDIGKNLGAFFTHQESFKEAEKEAKKNPLPKNISINEEAMNRILRQQQLEQMETDLREMIIYQIGMPGLWSKFVEMREVVRKEREKVEREQKKPWSWLLSKDGNSLTNGKFVHRYLLAALSS* |
| ⦗Top⦘ |