Scaffold Ga0136236_1000218

Overview

Basic Information

• Taxon OID: 3300010230
• Scaffold ID: Ga0136236_1000218
• Source Dataset Name: Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8820
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk

Source Dataset Sampling Location

• Location Name: Conwy River, Conwy, North Wales, UK
• Coordinates
  • Lat. (^o): 53.2
  • Long. (^o): -3.82

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003640	Metagenome / Metatranscriptome	475	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136236_10002184	F003640	GAG	MLAVVYDPRYHTFDSWASLMCEAYAGQQLSIPNESTDWQEWAAGLKAIDVFMNEGIPGPYNFNKWQDWAQALVGAVNQPTVE*