Scaffold Ga0136218_1000617

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136218_1000617

Scaffold Ga0136218_1000617

Overview

Basic Information
Taxon OID	3300010229 Open in IMG/M
Scaffold ID	Ga0136218_1000617 Open in IMG/M
Source Dataset Name	Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6575
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (27.27%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location
Location Name	Bangor area, North Wales, UK
Coordinates	Lat. (^o)	53.24	Long. (^o)	-4.01	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019257	Metagenome / Metatranscriptome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136218_100061710	F019257	N/A	VRLAARGQRDMDTGPEQISDAEELRMVQRQARAVYVKAIITAAILTAAALVF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.