Basic Information | |
---|---|
Taxon OID | 3300010206 Open in IMG/M |
Scaffold ID | Ga0136454_100090 Open in IMG/M |
Source Dataset Name | Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCP16c |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 666882 |
Total Scaffold Genes | 516 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 63 (12.21%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Waban, Wellesley MA | |||||||
Coordinates | Lat. (o) | 42.2876 | Long. (o) | -71.30117 | Alt. (m) | Depth (m) | .3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087946 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136454_100090309 | F087946 | N/A | MLSKERLPDIIVIALLLLILLAMNYFKIIHVIGNYPFVFLLIMYFIGRAVTWYVISKHMDKDE* |
⦗Top⦘ |