| Basic Information | |
|---|---|
| Taxon OID | 3300010204 Open in IMG/M |
| Scaffold ID | Ga0136456_104031 Open in IMG/M |
| Source Dataset Name | Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCF4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3343 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Waban, Wellesley MA | |||||||
| Coordinates | Lat. (o) | 42.2876 | Long. (o) | -71.30117 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136456_1040312 | F017253 | N/A | MSIYANDRVALTLAPNVGSYTQGRTAGDFLSSRKAARAERCTPKTTAADLDG* |
| ⦗Top⦘ |