Scaffold Ga0127508_1014003

Overview

Basic Information

• Taxon OID: 3300010199
• Scaffold ID: Ga0127508_1014003
• Source Dataset Name: Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2295
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers II → Araucariales → Araucariaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location

• Location Name: USA: Minnesota
• Coordinates
  • Lat. (^o): 47.5028
  • Long. (^o): -93.4828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018495	Metagenome / Metatranscriptome	234	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127508_10140031	F018495	N/A	ELMNSVGSHGSSSLPFVMKVMVCHFVSDSHEVMTALIVVLPLTVVVEISLQLH*