| Basic Information | |
|---|---|
| Taxon OID | 3300010192 Open in IMG/M |
| Scaffold ID | Ga0127506_1187006 Open in IMG/M |
| Source Dataset Name | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum fallax MT (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 674 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003575 | Metagenome / Metatranscriptome | 478 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127506_11870061 | F003575 | N/A | KYLVHDLNPTCNSNNPNLTIVFFHGIAFGTNDEWKETWTTCPLNNKEERICWPQKWLPEDLNNNVRILSLSYDSNIVASVYNDVTEIGKNLVQSLVTNSRCDNLLYLWTH* |
| ⦗Top⦘ |