NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126306_11746722

Scaffold Ga0126306_11746722


Overview

Basic Information
Taxon OID3300010166 Open in IMG/M
Scaffold IDGa0126306_11746722 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8692Long. (o)-122.4282Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039022Metagenome164N

Sequences

Protein IDFamilyRBSSequence
Ga0126306_117467221F039022N/ALIGNNTFSNLFDFHLDPWYLSAMYVLCAVFVGLLVAGGLIAFAEKVLRETFFARYGLMVLAICIGGAALAILLTTVTYIFDDAAYVPRGTTEATYTLVLVTIPGATLGAIEGVILAFPLAWLLGLIGKRN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.