Scaffold Ga0126306_11336582

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126306_11336582

Scaffold Ga0126306_11336582

Overview

Basic Information
Taxon OID	3300010166 Open in IMG/M
Scaffold ID	Ga0126306_11336582 Open in IMG/M
Source Dataset Name	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	592
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location Name	UC McLaughlin Reserve (Lake County, CA)
Coordinates	Lat. (^o)	38.8692	Long. (^o)	-122.4282	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019851	Metagenome	227	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0126306_113365822	F019851	N/A	VSRASSVSVTEIACHHNKVLATWHADTDEWTYQHRVARKRPTQKQSEQLAKMFDQASSATRRRNET*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.