NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114964_10050508

Scaffold Ga0114964_10050508


Overview

Basic Information
Taxon OID3300010157 Open in IMG/M
Scaffold IDGa0114964_10050508 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2181
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051929Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0114964_100505083F051929AGAAGGMTEQRYLAGGAEFLYPHAGDPKAPESTKLLLLTTGGICTTGIWHRDWCLGWLPLPKRNMEKEDKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.