Scaffold Ga0127503_10486457

Overview

Basic Information

• Taxon OID: 3300010154
• Scaffold ID: Ga0127503_10486457
• Source Dataset Name: Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 595
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location

• Location Name: USA: Willow Creek, Wisconsin
• Coordinates
  • Lat. (^o): 45.8056
  • Long. (^o): -90.0794
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013938	Metagenome / Metatranscriptome	267	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127503_104864571	F013938	AGGA	MADEKQARLEARARIDIRKLYERGEITLKDHASAVGYLRGVWFDHLSDIEIDDFISREIRKLEPSKIQPAE*