| Basic Information | |
|---|---|
| Taxon OID | 3300010154 Open in IMG/M |
| Scaffold ID | Ga0127503_10052692 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1147 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Willow Creek, Wisconsin | |||||||
| Coordinates | Lat. (o) | 45.8056 | Long. (o) | -90.0794 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047952 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127503_100526921 | F047952 | GAG | MTWGSLRIEVRDDEIIVTQPGSNFSAVYYKPRDEPQLIAKGTPSGNYRFLARAWKAANDKARELGWIV* |
| ⦗Top⦘ |