NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126318_10456456

Scaffold Ga0126318_10456456


Overview

Basic Information
Taxon OID3300010152 Open in IMG/M
Scaffold IDGa0126318_10456456 Open in IMG/M
Source Dataset NameSoil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)667
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location NameSouthern Great Plains ARM Site, Oklahoma
CoordinatesLat. (o)36.605Long. (o)-97.485Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004129Metagenome / Metatranscriptome451Y

Sequences

Protein IDFamilyRBSSequence
Ga0126318_104564561F004129GGAGMVDEGRSGYAGSTRPWEDRSGRAVGTILATAVAAGVIAYILRRTREEQEEPASRVAKLARDWAGSDRVDAGREFVMDKILPELKPALLSALSEIEDIVDQAFSRIEKNIKKL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.