Scaffold Ga0098049_1268925

Overview

Basic Information

• Taxon OID: 3300010149
• Scaffold ID: Ga0098049_1268925
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 517
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -14.509
  • Long. (^o): -76.198
  • Depth (m): 48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070305	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098049_12689252	F070305	N/A	RKTYLVECDSVSVAESKVNEWLKTSPFAFETIIAKQSKIVDVVE*