NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126322_1124569

Scaffold Ga0126322_1124569


Overview

Basic Information
Taxon OID3300010143 Open in IMG/M
Scaffold IDGa0126322_1124569 Open in IMG/M
Source Dataset NameSoil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)561
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location NameMekong River Delta, Cambodia
CoordinatesLat. (o)11.5058Long. (o)105.0087Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005763Metagenome / Metatranscriptome391Y
F013518Metagenome / Metatranscriptome270N

Sequences

Protein IDFamilyRBSSequence
Ga0126322_11245691F013518N/AMWEPRALDALEQLAEYMPAAARDALDAMERMASTGFNYGRLTTKGILWYFPTPKLGLFYLDDGRTLTVVDVVDARRLRRLP*
Ga0126322_11245692F005763N/AQDDWVLDEAEALLDMDGRRERLDLVVADLQSGKVAPVDQATARDRIEQRIRDRRTR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.