Scaffold Ga0126323_1066711

Overview

Basic Information

• Taxon OID: 3300010137
• Scaffold ID: Ga0126323_1066711
• Source Dataset Name: Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC1 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 861
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location

• Location Name: Stunt Ranch Reserve, CA
• Coordinates
  • Lat. (^o): 34.0938
  • Long. (^o): -118.6572
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002520	Metagenome / Metatranscriptome	552	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126323_10667111	F002520	N/A	KTGVCVMLDQKVDDRGTDQEEAQHMIEALRDGGFDGDNEKLAKALGRTIEQVDAMIKGAETIDDDVVMKARGIALNRGIPIERS*