Scaffold Ga0123382_1182960

Overview

Basic Information

• Taxon OID: 3300010135
• Scaffold ID: Ga0123382_1182960
• Source Dataset Name: Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones

Source Dataset Sampling Location

• Location Name: Louisana Shelf, Hypoxic Zone, Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.8679
  • Long. (^o): -90.4764

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010165	Metatranscriptome	307	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0123382_11829601	F010165	N/A	VGFEGACKYHDYGNVMSVAEVPDCFDVNECLAECHPITDKWGACYVDDKEGVERAQRCLCAPMPGASGDAFIQTLLRGACLTSQIGYLDRAYNGLCKFPDERVQPVYQCESIPTFNARNSAVACNPGVGFNVACFSVRRRTPWQCAAEAEMNPSCRTTQLVPQDGSPFYDGACVFEGASGWAQ