NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126316_1044316

Scaffold Ga0126316_1044316


Overview

Basic Information
Taxon OID3300010110 Open in IMG/M
Scaffold IDGa0126316_1044316 Open in IMG/M
Source Dataset NameSoil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1301
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location NameFluxnet siteBondville, Illinois
CoordinatesLat. (o)40.0062Long. (o)-88.2904Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013832Metagenome / Metatranscriptome268Y

Sequences

Protein IDFamilyRBSSequence
Ga0126316_10443161F013832GGAMRNRSIRGLYVLAASVAVSSALGLAGATAASAGVHVRPHATTVCDNNPGTVSPRCTNISNLMLNQGNGPVFIQNATQKGVTAGSLYKNRIINLRQASNTRTNEDFIIRQVGVLGQLCGTGGVNSIDPTSYACLNYPDFYPVFQGQFAPNSNESGFCVGAISATEGFKVRLRRCGSPQSFWVGDLAASIQVTVVLNNAPFLLFYFPLEFAADTSASNPLVMTLNPNSKNPSNLLTLQQENFSGGLVPDRQMFTLTFPTGFIVHN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.